![]() | Class g: Small proteins [56992] (94 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (23 proteins) |
![]() | Protein Coagulation factor VIIa [57201] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57202] (96 PDB entries) Uniprot P08709 108-202 ! Uniprot P08709 107-202 |
![]() | Domain d1danl2: 1dan L:87-142 [44210] Other proteins in same PDB: d1dan.1, d1danh_, d1danl3, d1danu1 complexed with 0z6, bgc, ca, cac, cl, fuc |
PDB Entry: 1dan (more details), 2 Å
SCOPe Domain Sequences for d1danl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1danl2 g.3.11.1 (L:87-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile
Timeline for d1danl2:
![]() Domains from other chains: (mouse over for more information) d1dan.1, d1dan.1, d1danh_, d1danu1 |