Lineage for d1danl1 (1dan L:49-86)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 88440Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 88834Superfamily g.3.11: EGF/Laminin [57196] (5 families) (S)
  5. 88835Family g.3.11.1: EGF-type module [57197] (17 proteins)
  6. 88840Protein Coagulation factor VIIa [57201] (1 species)
  7. 88841Species Human (Homo sapiens) [TaxId:9606] [57202] (11 PDB entries)
  8. 88842Domain d1danl1: 1dan L:49-86 [44209]
    Other proteins in same PDB: d1dan.1, d1danh_, d1danl3, d1danu1

Details for d1danl1

PDB Entry: 1dan (more details), 2 Å

PDB Description: complex of active site inhibited human blood coagulation factor viia with human recombinant soluble tissue factor

SCOP Domain Sequences for d1danl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1danl1 g.3.11.1 (L:49-86) Coagulation factor VIIa {Human (Homo sapiens)}
qcasspcqnggsckdqlqsyicfclpafegrncethkd

SCOP Domain Coordinates for d1danl1:

Click to download the PDB-style file with coordinates for d1danl1.
(The format of our PDB-style files is described here.)

Timeline for d1danl1: