Lineage for d1pfxl2 (1pfx L:87-146)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635893Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2635894Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2636083Protein Factor IX (IXa) [57198] (2 species)
  7. 2636118Species Pig (Sus scrofa) [TaxId:9823] [57200] (2 PDB entries)
  8. 2636120Domain d1pfxl2: 1pfx L:87-146 [44208]
    Other proteins in same PDB: d1pfxc_, d1pfxl3
    complexed with 0g6

Details for d1pfxl2

PDB Entry: 1pfx (more details), 3 Å

PDB Description: porcine factor ixa
PDB Compounds: (L:) factor ixa

SCOPe Domain Sequences for d1pfxl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pfxl2 g.3.11.1 (L:87-146) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}
tcnikngrckqfcktgadskvlcscttgyrlapdqksckpavpfpcgrvsvshspttltr

SCOPe Domain Coordinates for d1pfxl2:

Click to download the PDB-style file with coordinates for d1pfxl2.
(The format of our PDB-style files is described here.)

Timeline for d1pfxl2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pfxc_