Lineage for d1pfxl2 (1pfx L:87-146)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39579Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)
  4. 39963Superfamily g.3.11: EGF/Laminin [57196] (4 families) (S)
  5. 39964Family g.3.11.1: EGF-type module [57197] (16 proteins)
  6. 40002Protein Factor IX (IXa) [57198] (2 species)
  7. 40008Species Pig (Sus scrofa) [TaxId:9823] [57200] (1 PDB entry)
  8. 40010Domain d1pfxl2: 1pfx L:87-146 [44208]
    Other proteins in same PDB: d1pfxc_, d1pfxl3

Details for d1pfxl2

PDB Entry: 1pfx (more details), 3 Å

PDB Description: porcine factor ixa

SCOP Domain Sequences for d1pfxl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pfxl2 g.3.11.1 (L:87-146) Factor IX (IXa) {Pig (Sus scrofa)}
tcnikngrckqfcktgadskvlcscttgyrlapdqksckpavpfpcgrvsvshspttltr

SCOP Domain Coordinates for d1pfxl2:

Click to download the PDB-style file with coordinates for d1pfxl2.
(The format of our PDB-style files is described here.)

Timeline for d1pfxl2:

40010
d1pfxl2 in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1pfxc_