Lineage for d1pfxl1 (1pfx L:47-86)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 88440Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 88834Superfamily g.3.11: EGF/Laminin [57196] (5 families) (S)
  5. 88835Family g.3.11.1: EGF-type module [57197] (17 proteins)
  6. 88874Protein Factor IX (IXa) [57198] (2 species)
  7. 88880Species Pig (Sus scrofa) [TaxId:9823] [57200] (1 PDB entry)
  8. 88881Domain d1pfxl1: 1pfx L:47-86 [44207]
    Other proteins in same PDB: d1pfxc_, d1pfxl3

Details for d1pfxl1

PDB Entry: 1pfx (more details), 3 Å

PDB Description: porcine factor ixa

SCOP Domain Sequences for d1pfxl1:

Sequence, based on SEQRES records: (download)

>d1pfxl1 g.3.11.1 (L:47-86) Factor IX (IXa) {Pig (Sus scrofa)}
dgdqcepnpclngglckxdinsyecwcqvgfegkncelda

Sequence, based on observed residues (ATOM records): (download)

>d1pfxl1 g.3.11.1 (L:47-86) Factor IX (IXa) {Pig (Sus scrofa)}
dgdqcepnpclngglckdinsyecwcqvgfegkncelda

SCOP Domain Coordinates for d1pfxl1:

Click to download the PDB-style file with coordinates for d1pfxl1.
(The format of our PDB-style files is described here.)

Timeline for d1pfxl1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pfxc_