Lineage for d1ixa__ (1ixa -)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 202518Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 202990Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 202991Family g.3.11.1: EGF-type module [57197] (18 proteins)
  6. 203049Protein Factor IX (IXa) [57198] (2 species)
  7. 203050Species Human (Homo sapiens) [TaxId:9606] [57199] (3 PDB entries)
  8. 203054Domain d1ixa__: 1ixa - [44206]

Details for d1ixa__

PDB Entry: 1ixa (more details)

PDB Description: the three-dimensional structure of the first egf-like module of human factor ix: comparison with egf and tgf-a

SCOP Domain Sequences for d1ixa__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ixa__ g.3.11.1 (-) Factor IX (IXa) {Human (Homo sapiens)}
vdgdqcesnpclnggsckddinsyecwcpfgfegkncel

SCOP Domain Coordinates for d1ixa__:

Click to download the PDB-style file with coordinates for d1ixa__.
(The format of our PDB-style files is described here.)

Timeline for d1ixa__: