Lineage for d1rfnb_ (1rfn B:)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 268805Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
    disulphide-bound fold; contains beta-hairpin with two adjacent disulphides
  4. 269314Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 269315Family g.3.11.1: EGF-type module [57197] (18 proteins)
  6. 269377Protein Factor IX (IXa) [57198] (2 species)
  7. 269378Species Human (Homo sapiens) [TaxId:9606] [57199] (3 PDB entries)
  8. 269381Domain d1rfnb_: 1rfn B: [44205]
    Other proteins in same PDB: d1rfna_
    complexed with ca, pbz, tbu

Details for d1rfnb_

PDB Entry: 1rfn (more details), 2.8 Å

PDB Description: human coagulation factor ixa in complex with p-amino benzamidine

SCOP Domain Sequences for d1rfnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens)}
mtcnikngrceqfcknsadnkvvcsctegyrlaenqkscepavpfpcgrvsvsqtsk

SCOP Domain Coordinates for d1rfnb_:

Click to download the PDB-style file with coordinates for d1rfnb_.
(The format of our PDB-style files is described here.)

Timeline for d1rfnb_: