Lineage for d1rfnb_ (1rfn B:)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 142669Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 143091Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 143092Family g.3.11.1: EGF-type module [57197] (17 proteins)
  6. 143145Protein Factor IX (IXa) [57198] (2 species)
  7. 143146Species Human (Homo sapiens) [TaxId:9606] [57199] (3 PDB entries)
  8. 143149Domain d1rfnb_: 1rfn B: [44205]
    Other proteins in same PDB: d1rfna_

Details for d1rfnb_

PDB Entry: 1rfn (more details), 2.8 Å

PDB Description: human coagulation factor ixa in complex with p-amino benzamidine

SCOP Domain Sequences for d1rfnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens)}
mtcnikngrceqfcknsadnkvvcsctegyrlaenqkscepavpfpcgrvsvsqtsk

SCOP Domain Coordinates for d1rfnb_:

Click to download the PDB-style file with coordinates for d1rfnb_.
(The format of our PDB-style files is described here.)

Timeline for d1rfnb_: