Lineage for d1edmc_ (1edm C:)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 88440Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 88834Superfamily g.3.11: EGF/Laminin [57196] (5 families) (S)
  5. 88835Family g.3.11.1: EGF-type module [57197] (17 proteins)
  6. 88874Protein Factor IX (IXa) [57198] (2 species)
  7. 88875Species Human (Homo sapiens) [TaxId:9606] [57199] (3 PDB entries)
  8. 88877Domain d1edmc_: 1edm C: [44204]

Details for d1edmc_

PDB Entry: 1edm (more details), 1.5 Å

PDB Description: epidermal growth factor-like domain from human factor ix

SCOP Domain Sequences for d1edmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1edmc_ g.3.11.1 (C:) Factor IX (IXa) {Human (Homo sapiens)}
vdgdqcesnpclnggsckddinsyecwcpfgfegkncel

SCOP Domain Coordinates for d1edmc_:

Click to download the PDB-style file with coordinates for d1edmc_.
(The format of our PDB-style files is described here.)

Timeline for d1edmc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1edmb_