SCOPe 2.05: Domain d1pcna2: 1pcn A:45-93

Lineage for d1pcna2 (1pcn A:45-93)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.10: Colipase-like [57190] (2 families)

5. Family g.3.10.1: Colipase-like [57191] (2 proteins)

6. Protein (Pro)colipase [57192] (1 species)
   duplication: consists of two (sub)domains of this common fold

7. Species Pig (Sus scrofa) [TaxId:9823] [57193] (6 PDB entries)

8. Domain d1pcna2: 1pcn A:45-93 [44200]
   complexed with oh

Details for d1pcna2

PDB Entry: 1pcn

PDB Description: solution structure of porcine pancreatic procolipase as determined from 1h homonuclear two-and three-dimensional nmr

PDB Compounds: (A:) porcine pancreatic procolipase b

SCOPe Domain Sequences for d1pcna2:

Sequence; same for both SEQRES and ATOM records:

>d1pcna2 g.3.10.1 (A:45-93) (Pro)colipase {Pig (Sus scrofa) [TaxId: 9823]}
ensecsaftlygvyykcpcergltcegdkslvgsitntnfgichnvgrs

Timeline for d1pcna2:

• d1pcna2 first appeared (with stable ids) in SCOP 1.55, called d1pcn_2
  
• d1pcna2 appears in SCOPe 2.04
  
• d1pcna2 appears in SCOPe 2.06
  
• d1pcna2 appears in the current release, SCOPe 2.08