Lineage for d1pcoa2 (1pco A:45-93)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031110Superfamily g.3.10: Colipase-like [57190] (2 families) (S)
  5. 3031111Family g.3.10.1: Colipase-like [57191] (2 proteins)
  6. 3031112Protein (Pro)colipase [57192] (1 species)
    duplication: consists of two (sub)domains of this common fold
  7. 3031113Species Pig (Sus scrofa) [TaxId:9823] [57193] (6 PDB entries)
  8. 3031127Domain d1pcoa2: 1pco A:45-93 [44198]
    complexed with oh

Details for d1pcoa2

PDB Entry: 1pco (more details)

PDB Description: solution structure of porcine pancreatic procolipase as determined from 1h homonuclear two-and three-dimensional nmr
PDB Compounds: (A:) porcine pancreatic procolipase b

SCOPe Domain Sequences for d1pcoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pcoa2 g.3.10.1 (A:45-93) (Pro)colipase {Pig (Sus scrofa) [TaxId: 9823]}
ensecsaftlygvyykcpcergltcegdkslvgsitntnfgichnvgrs

SCOPe Domain Coordinates for d1pcoa2:

Click to download the PDB-style file with coordinates for d1pcoa2.
(The format of our PDB-style files is described here.)

Timeline for d1pcoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pcoa1