Lineage for d1ethd2 (1eth D:45-90)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2258067Superfamily g.3.10: Colipase-like [57190] (2 families) (S)
  5. 2258068Family g.3.10.1: Colipase-like [57191] (2 proteins)
  6. 2258069Protein (Pro)colipase [57192] (1 species)
    duplication: consists of two (sub)domains of this common fold
  7. 2258070Species Pig (Sus scrofa) [TaxId:9823] [57193] (6 PDB entries)
  8. 2258078Domain d1ethd2: 1eth D:45-90 [44196]
    Other proteins in same PDB: d1etha1, d1etha2, d1ethc1, d1ethc2
    complexed with bme, c8e, ca

Details for d1ethd2

PDB Entry: 1eth (more details), 2.8 Å

PDB Description: triacylglycerol lipase/colipase complex
PDB Compounds: (D:) colipase

SCOPe Domain Sequences for d1ethd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ethd2 g.3.10.1 (D:45-90) (Pro)colipase {Pig (Sus scrofa) [TaxId: 9823]}
ensecsaftlygvyykcpcergltcegdkslvgsitntnfgichnv

SCOPe Domain Coordinates for d1ethd2:

Click to download the PDB-style file with coordinates for d1ethd2.
(The format of our PDB-style files is described here.)

Timeline for d1ethd2: