Lineage for d1lpaa2 (1lpa A:45-90)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1960255Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1961179Superfamily g.3.10: Colipase-like [57190] (2 families) (S)
  5. 1961180Family g.3.10.1: Colipase-like [57191] (2 proteins)
  6. 1961181Protein (Pro)colipase [57192] (1 species)
    duplication: consists of two (sub)domains of this common fold
  7. 1961182Species Pig (Sus scrofa) [TaxId:9823] [57193] (6 PDB entries)
  8. 1961186Domain d1lpaa2: 1lpa A:45-90 [44192]
    Other proteins in same PDB: d1lpab1, d1lpab2
    complexed with bng, ca, plc

Details for d1lpaa2

PDB Entry: 1lpa (more details), 3.04 Å

PDB Description: interfacial activation of the lipase-procolipase complex by mixed micelles revealed by x-ray crystallography
PDB Compounds: (A:) colipase

SCOPe Domain Sequences for d1lpaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lpaa2 g.3.10.1 (A:45-90) (Pro)colipase {Pig (Sus scrofa) [TaxId: 9823]}
ensecsaftlygvyykcpcergltcegdkslvgsitntnfgichnv

SCOPe Domain Coordinates for d1lpaa2:

Click to download the PDB-style file with coordinates for d1lpaa2.
(The format of our PDB-style files is described here.)

Timeline for d1lpaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lpaa1