SCOPe 2.01: Domain d1igra3: 1igr A:150-299

Lineage for d1igra3 (1igr A:150-299)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.9: Growth factor receptor domain [57184] (1 family)

5. Family g.3.9.1: Growth factor receptor domain [57185] (9 proteins)

6. Protein Type 1 insulin-like growth factor receptor Cys-rich domain [57188] (1 species)
   contains 3 cystine-knot subdomains and 4 single-disulfide cystine knot-like subdomains

7. Species Human (Homo sapiens) [TaxId:9606] [57189] (1 PDB entry)

8. Domain d1igra3: 1igr A:150-299 [44188]
   Other proteins in same PDB: d1igra1, d1igra2
   complexed with nag, so4

Details for d1igra3

PDB Entry: 1igr, 2.6 Å

PDB Description: type 1 insulin-like growth factor receptor (domains 1-3)

PDB Compounds: (A:) insulin-like growth factor receptor 1

SCOPe Domain Sequences for d1igra3:

Sequence; same for both SEQRES and ATOM records:

>d1igra3 g.3.9.1 (A:150-299) Type 1 insulin-like growth factor receptor Cys-rich domain {Human (Homo sapiens) [TaxId: 9606]}
dlcpgtmeekpmcekttinneynyrcwttnrcqkmcpstcgkractennecchpeclgsc
sapdndtacvacrhyyyagvcvpacppntyrfegwrcvdrdfcanilsaessdsegfvih
dgecmqecpsgfirngsqsmycipcegpcp

Timeline for d1igra3:

• d1igra3 first appeared (with stable ids) in SCOP 1.55
  
• d1igra3 appears in SCOP 1.75
  
• d1igra3 appears in SCOPe 2.02
  
• d1igra3 appears in the current release, SCOPe 2.08