SCOPe 2.08: Domain d1boea_: 1boe A:

Lineage for d1boea_ (1boe A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.9: Growth factor receptor domain [57184] (2 families)

5. Family g.3.9.1: Growth factor receptor domain [57185] (11 proteins)
   Pfam PF00757; Pfam PF14843; Pfam PF15913
   heterogeneous fold; applies to domains that adopt a different fold than the exemplar domain but has similar sequence and number of secondary structures
   

6. Protein Insulin-like growth factor-binding protein-5 (IGFBP-5) [57186] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57187] (2 PDB entries)

8. Domain d1boea_: 1boe A: [44187]

Details for d1boea_

PDB Entry: 1boe

PDB Description: structure of the igf binding domain of the insulin-like growth factor- binding protein-5 (igfbp-5): implications for igf and igf-i receptor interactions

PDB Compounds: (A:) protein (insulin-like growth factor-binding protein-5 (igfbp-5))

SCOPe Domain Sequences for d1boea_:

Sequence; same for both SEQRES and ATOM records:

>d1boea_ g.3.9.1 (A:) Insulin-like growth factor-binding protein-5 (IGFBP-5) {Human (Homo sapiens) [TaxId: 9606]}
alaegqscgvytercaqglrclprqdeekplhallhgrgvclneks

Timeline for d1boea_:

• d1boea_ first appeared (with stable ids) in SCOP 1.55
  
• d1boea_ appears in SCOPe 2.07