Class g: Small proteins [56992] (100 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) |
Family g.3.9.1: Growth factor receptor domain [57185] (11 proteins) Pfam PF00757; Pfam PF14843; Pfam PF15913 heterogeneous fold; applies to domains that adopt a different fold than the exemplar domain but has similar sequence and number of secondary structures |
Protein Insulin-like growth factor-binding protein-5 (IGFBP-5) [57186] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57187] (2 PDB entries) |
Domain d1boea_: 1boe A: [44187] |
PDB Entry: 1boe (more details)
SCOPe Domain Sequences for d1boea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1boea_ g.3.9.1 (A:) Insulin-like growth factor-binding protein-5 (IGFBP-5) {Human (Homo sapiens) [TaxId: 9606]} alaegqscgvytercaqglrclprqdeekplhallhgrgvclneks
Timeline for d1boea_: