Lineage for d1g1pa_ (1g1p A:)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 427258Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 427455Superfamily g.3.6: omega toxin-like [57059] (4 families) (S)
  5. 427456Family g.3.6.1: Conotoxin [57060] (1 protein)
  6. 427457Protein Conotoxin [57061] (12 species)
  7. 427458Species Conus ermineus, E VIa [TaxId:55423] [57070] (2 PDB entries)
  8. 427459Domain d1g1pa_: 1g1p A: [44099]
    complexed with nh2

Details for d1g1pa_

PDB Entry: 1g1p (more details)

PDB Description: nmr solution structures of delta-conotoxin evia from conus ermineus that selectively acts on vertebrate neuronal na+ channels

SCOP Domain Sequences for d1g1pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g1pa_ g.3.6.1 (A:) Conotoxin {Conus ermineus, E VIa}
ddcikpygfcslpilknglccsgacvgvcadl

SCOP Domain Coordinates for d1g1pa_:

Click to download the PDB-style file with coordinates for d1g1pa_.
(The format of our PDB-style files is described here.)

Timeline for d1g1pa_: