Class g: Small proteins [56992] (79 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.3: Cyclotides [57038] (4 families) macrocyclic plant knottins closed with the formation of an Asn-Gly peptide |
Family g.3.3.3: Circulin A [57045] (1 protein) |
Protein Circulin A [57046] (1 species) cyclic 30-residue polypeptide |
Species Chassalia parviflora [TaxId:58431] [57047] (1 PDB entry) |
Domain d1bh4__: 1bh4 - [44079] by homology with the Kalata B1 linear precursor, the mature protein sequence probably begins at Gly28 and ends at Asn27 |
PDB Entry: 1bh4 (more details)
SCOP Domain Sequences for d1bh4__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bh4__ g.3.3.3 (-) Circulin A {Chassalia parviflora} cgescvwipcisaalgcscknkvcyrngip
Timeline for d1bh4__: