Lineage for d1bh4__ (1bh4 -)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 621450Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 621612Superfamily g.3.3: Cyclotides [57038] (4 families) (S)
    macrocyclic plant knottins closed with the formation of an Asn-Gly peptide
  5. 621631Family g.3.3.3: Circulin A [57045] (1 protein)
  6. 621632Protein Circulin A [57046] (1 species)
    cyclic 30-residue polypeptide
  7. 621633Species Chassalia parviflora [TaxId:58431] [57047] (1 PDB entry)
  8. 621634Domain d1bh4__: 1bh4 - [44079]
    by homology with the Kalata B1 linear precursor, the mature protein sequence probably begins at Gly28 and ends at Asn27

Details for d1bh4__

PDB Entry: 1bh4 (more details)

PDB Description: circulin a from chassalia parviflora, nmr, 12 structures

SCOP Domain Sequences for d1bh4__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bh4__ g.3.3.3 (-) Circulin A {Chassalia parviflora}
cgescvwipcisaalgcscknkvcyrngip

SCOP Domain Coordinates for d1bh4__:

Click to download the PDB-style file with coordinates for d1bh4__.
(The format of our PDB-style files is described here.)

Timeline for d1bh4__: