Lineage for d1bh4__ (1bh4 -)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39579Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)
  4. 39679Superfamily g.3.3: Cyclotides [57038] (3 families) (S)
  5. 39688Family g.3.3.3: Circulin A [57045] (1 protein)
  6. 39689Protein Circulin A [57046] (1 species)
  7. 39690Species Chassalia parviflora [TaxId:58431] [57047] (1 PDB entry)
  8. 39691Domain d1bh4__: 1bh4 - [44079]

Details for d1bh4__

PDB Entry: 1bh4 (more details)

PDB Description: circulin a from chassalia parviflora, nmr, 12 structures

SCOP Domain Sequences for d1bh4__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bh4__ g.3.3.3 (-) Circulin A {Chassalia parviflora}
cgescvwipcisaalgcscknkvcyrngip

SCOP Domain Coordinates for d1bh4__:

Click to download the PDB-style file with coordinates for d1bh4__.
(The format of our PDB-style files is described here.)

Timeline for d1bh4__: