Lineage for d1svb_2 (1svb 1-302)

  1. Root: SCOP 1.55
  2. 38777Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 39373Fold f.10: Envelope glycoprotein, central and dimerisation domains [56982] (1 superfamily)
  4. 39374Superfamily f.10.1: Envelope glycoprotein, central and dimerisation domains [56983] (1 family) (S)
  5. 39375Family f.10.1.1: Envelope glycoprotein, central and dimerisation domains [56984] (1 protein)
  6. 39376Protein Envelope glycoprotein, central and dimerisation domains [56985] (1 species)
  7. 39377Species Tick-borne encephalitis virus [TaxId:11084] [56986] (1 PDB entry)
  8. 39378Domain d1svb_2: 1svb 1-302 [43827]
    Other proteins in same PDB: d1svb_1

Details for d1svb_2

PDB Entry: 1svb (more details), 1.9 Å

PDB Description: envelope glycoprotein from tick-borne encephalitis virus

SCOP Domain Sequences for d1svb_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1svb_2 f.10.1.1 (1-302) Envelope glycoprotein, central and dimerisation domains {Tick-borne encephalitis virus}
srcthlenrdfvtgtqgttrvtlvlelggcvtitaegkpsmdvwldaiyqenpaktreyc
lhaklsdtkvaarcptmgpatlaeehqggtvckrdqsdrgwgnhcglfgkgsivacvkaa
ceakkkatghvydankivytvkvephtgdyvaanethsgrktasftissektiltmgeyg
dvsllcrvasgvdlaqtvileldktvehlptawqvhrdwfndlalpwkhegaqnwnnaer
lvefgaphavkmdvynlgdqtgvllkalagvpvahiegtkyhlksghvtcevgleklkmk
gl

SCOP Domain Coordinates for d1svb_2:

Click to download the PDB-style file with coordinates for d1svb_2.
(The format of our PDB-style files is described here.)

Timeline for d1svb_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1svb_1