Lineage for d1fump_ (1fum P:)

  1. Root: SCOP 1.59
  2. 141686Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 141752Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 141753Superfamily f.2.1: Membrane all-alpha [56869] (11 families) (S)
  5. 142150Family f.2.1.9: Fumarate reductase respiratory complex transmembrane subunits [56910] (1 protein)
  6. 142151Protein Fumarate reductase respiratory complex transmembrane subunits [56911] (2 species)
  7. 142152Species Escherichia coli [TaxId:562] [56912] (1 PDB entry)
  8. 142156Domain d1fump_: 1fum P: [43721]
    Other proteins in same PDB: d1fuma1, d1fuma2, d1fuma3, d1fumb1, d1fumb2, d1fumm1, d1fumm2, d1fumm3, d1fumn1, d1fumn2

Details for d1fump_

PDB Entry: 1fum (more details), 3.3 Å

PDB Description: structure of the e. coli fumarate reductase respiratory complex

SCOP Domain Sequences for d1fump_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fump_ f.2.1.9 (P:) Fumarate reductase respiratory complex transmembrane subunits {Escherichia coli}
inpnpkrsdepvfwglfgaggmwsaiiapvmillvgillplglfpgdalsyervlafaqs
figrvflflmivlplwcglhrmhhamhdlkihvpagkwvfyglaailtvvtligvvti

SCOP Domain Coordinates for d1fump_:

Click to download the PDB-style file with coordinates for d1fump_.
(The format of our PDB-style files is described here.)

Timeline for d1fump_: