![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (40 superfamilies) not a true fold |
![]() | Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) ![]() automatically mapped to Pfam PF05365 |
![]() | Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins) |
![]() | Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species) interacts with cytochrome c1 and ISP |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [81510] (3 PDB entries) |
![]() | Domain d3bccj_: 3bcc J: [43717] Other proteins in same PDB: d3bcca1, d3bcca2, d3bccb1, d3bccb2, d3bccc2, d3bccc3, d3bccd2, d3bccd3, d3bcce1, d3bcce2, d3bccf_, d3bccg_, d3bcch_ complexed with amy, fes, hem, sig |
PDB Entry: 3bcc (more details), 3.7 Å
SCOPe Domain Sequences for d3bccj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bccj_ f.23.14.1 (J:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Chicken (Gallus gallus) [TaxId: 9031]} tltarlysllfrrtstfaltivvgallferafdqgadaiyehinegklwkhikhkyenk
Timeline for d3bccj_: