Lineage for d3bccj_ (3bcc J:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957421Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
    not a true fold
  4. 1958207Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) (S)
    automatically mapped to Pfam PF05365
  5. 1958208Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)
  6. 1958209Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species)
    interacts with cytochrome c1 and ISP
  7. 1958216Species Chicken (Gallus gallus) [TaxId:9031] [81510] (3 PDB entries)
  8. 1958219Domain d3bccj_: 3bcc J: [43717]
    Other proteins in same PDB: d3bcca1, d3bcca2, d3bccb1, d3bccb2, d3bccc2, d3bccc3, d3bccd2, d3bccd3, d3bcce1, d3bcce2, d3bccf_, d3bccg_, d3bcch_
    complexed with amy, fes, hem, sig

Details for d3bccj_

PDB Entry: 3bcc (more details), 3.7 Å

PDB Description: stigmatellin and antimycin bound cytochrome bc1 complex from chicken
PDB Compounds: (J:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d3bccj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bccj_ f.23.14.1 (J:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Chicken (Gallus gallus) [TaxId: 9031]}
tltarlysllfrrtstfaltivvgallferafdqgadaiyehinegklwkhikhkyenk

SCOPe Domain Coordinates for d3bccj_:

Click to download the PDB-style file with coordinates for d3bccj_.
(The format of our PDB-style files is described here.)

Timeline for d3bccj_: