Class f: Membrane and cell surface proteins and peptides [56835] (36 folds) |
Fold f.23: Single transmembrane helix [81407] (22 superfamilies) not a true fold |
Superfamily f.23.14: Subunit X (nonheme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) |
Family f.23.14.1: Subunit X (nonheme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (1 protein) |
Protein Subunit X (nonheme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species) inteacts with cytochrome c1 and ISP |
Species Chicken (Gallus gallus) [TaxId:9031] [81510] (3 PDB entries) |
Domain d3bccj_: 3bcc J: [43717] Other proteins in same PDB: d3bcca1, d3bcca2, d3bccb1, d3bccb2, d3bccc2, d3bccc3, d3bccd2, d3bccd3, d3bcce1, d3bcce2, d3bccf_, d3bccg_, d3bcch_ complexed with amy, fes, hem, sig |
PDB Entry: 3bcc (more details), 3.7 Å
SCOP Domain Sequences for d3bccj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bccj_ f.23.14.1 (J:) Subunit X (nonheme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Chicken (Gallus gallus)} tltarlysllfrrtstfaltivvgallferafdqgadaiyehinegklwkhikhkyenk
Timeline for d3bccj_: