![]() | Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) |
![]() | Fold f.2: Membrane all-alpha [56868] (1 superfamily) |
![]() | Superfamily f.2.1: Membrane all-alpha [56869] (10 families) ![]() |
![]() | Family f.2.1.8: Cytochrome bc1 transmembrane subunits [56906] (1 protein) |
![]() | Protein Cytochrome bc1 transmembrane subunits [56907] (2 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [56909] (3 PDB entries) |
![]() | Domain d3bccj1: 3bcc J: [43717] Other proteins in same PDB: d3bcca_, d3bccb_, d3bccd2, d3bcce1 |
PDB Entry: 3bcc (more details), 3.7 Å
SCOP Domain Sequences for d3bccj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bccj1 f.2.1.8 (J:) Cytochrome bc1 transmembrane subunits {Chicken (Gallus gallus)} tltarlysllfrrtstfaltivvgallferafdqgadaiyehinegklwkhikhkyenk
Timeline for d3bccj1: