Lineage for d3bcch_ (3bcc H:)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 268492Fold f.28: Nonheme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 268493Superfamily f.28.1: Nonheme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) (S)
    location - intermembrane side of the bc1 complex
  5. 268494Family f.28.1.1: Nonheme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (1 protein)
    "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1
  6. 268495Protein Nonheme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81529] (3 species)
  7. 268501Species Chicken (Gallus gallus) [TaxId:9031] [81527] (3 PDB entries)
  8. 268504Domain d3bcch_: 3bcc H: [43716]
    Other proteins in same PDB: d3bcca1, d3bcca2, d3bccb1, d3bccb2, d3bccc2, d3bccc3, d3bccd2, d3bccd3, d3bcce1, d3bcce2, d3bccf_, d3bccg_, d3bccj_
    complexed with amy, fes, hem, sig

Details for d3bcch_

PDB Entry: 3bcc (more details), 3.7 Å

PDB Description: stigmatellin and antimycin bound cytochrome bc1 complex from chicken

SCOP Domain Sequences for d3bcch_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bcch_ f.28.1.1 (H:) Nonheme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Chicken (Gallus gallus)}
lvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelfdflhardhcvahk
lfnslk

SCOP Domain Coordinates for d3bcch_:

Click to download the PDB-style file with coordinates for d3bcch_.
(The format of our PDB-style files is described here.)

Timeline for d3bcch_: