SCOP 1.63: Domain d3bccg_: 3bcc G:

Lineage for d3bccg_ (3bcc G:)

1. Root: SCOP 1.63

2. Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)

3. Fold f.23: Single transmembrane helix [81407] (22 superfamilies)
   not a true fold

4. Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family)

5. Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (1 protein)

6. Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
   together with cytochrome b binds to ubiquinone

7. Species Chicken (Gallus gallus) [TaxId:9031] [81504] (3 PDB entries)

8. Domain d3bccg_: 3bcc G: [43715]
   Other proteins in same PDB: d3bcca1, d3bcca2, d3bccb1, d3bccb2, d3bccc2, d3bccc3, d3bccd2, d3bccd3, d3bcce1, d3bcce2, d3bccf_, d3bcch_, d3bccj_
   complexed with amy, fes, hem, sig

Details for d3bccg_

PDB Entry: 3bcc, 3.7 Å

PDB Description: stigmatellin and antimycin bound cytochrome bc1 complex from chicken

SCOP Domain Sequences for d3bccg_:

Sequence; same for both SEQRES and ATOM records:

>d3bccg_ f.23.13.1 (G:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Chicken (Gallus gallus)}
rqfghltrvrhlityslspfeqrpfphyfskgvpnvwrrlracilrvappflafyllytw
gtqefekskrknpaayvn

Timeline for d3bccg_:

• d3bccg_ first appeared (with stable ids) in SCOP 1.55, called d3bccg1
  
• d3bccg_ was called d3bccg1 in SCOP 1.61
  
• d3bccg_ appears in SCOP 1.65
  
• d3bccg_ appears in the current release, SCOPe 2.08