Lineage for d3bccf_ (3bcc F:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1458053Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 1458054Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) (S)
    location - matrix side of the bc1 complex
    automatically mapped to Pfam PF02271
  5. 1458055Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
    probably important for the complex assembly, caps the matrix face of cytochrome b
  6. 1458056Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species)
  7. 1458063Species Chicken (Gallus gallus) [TaxId:9031] [81520] (3 PDB entries)
  8. 1458066Domain d3bccf_: 3bcc F: [43714]
    Other proteins in same PDB: d3bcca1, d3bcca2, d3bccb1, d3bccb2, d3bccc2, d3bccc3, d3bccd2, d3bccd3, d3bcce1, d3bcce2, d3bccg_, d3bcch_, d3bccj_
    complexed with amy, fes, hem, sig

Details for d3bccf_

PDB Entry: 3bcc (more details), 3.7 Å

PDB Description: stigmatellin and antimycin bound cytochrome bc1 complex from chicken
PDB Compounds: (F:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d3bccf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bccf_ f.27.1.1 (F:) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Chicken (Gallus gallus) [TaxId: 9031]}
srwlegirkwyynaagfnkyglmrddtiyenddvkeairrlpenlyddrmfrikraldln
mrqqilpkeqwtkyeedvpylepylkevirerkereewdk

SCOPe Domain Coordinates for d3bccf_:

Click to download the PDB-style file with coordinates for d3bccf_.
(The format of our PDB-style files is described here.)

Timeline for d3bccf_: