SCOPe 2.03: Domain d3bcce2: 3bcc E:1-69

Lineage for d3bcce2 (3bcc E:1-69)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.12: ISP transmembrane anchor [81502] (1 family)

5. Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)

6. Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [81498] (3 PDB entries)

8. Domain d3bcce2: 3bcc E:1-69 [43713]
   Other proteins in same PDB: d3bcca1, d3bcca2, d3bccb1, d3bccb2, d3bccc2, d3bccc3, d3bccd2, d3bccd3, d3bcce1, d3bccf_, d3bccg_, d3bcch_, d3bccj_
   complexed with amy, fes, hem, sig

Details for d3bcce2

PDB Entry: 3bcc, 3.7 Å

PDB Description: stigmatellin and antimycin bound cytochrome bc1 complex from chicken

PDB Compounds: (E:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d3bcce2:

Sequence; same for both SEQRES and ATOM records:

>d3bcce2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Chicken (Gallus gallus) [TaxId: 9031]}
shtdikvpnfsdyrrppddystkssresdpsrkgfsylvtavttlgvayaaknvvtqfvs
smsasadvl

Timeline for d3bcce2:

• d3bcce2 first appeared (with stable ids) in SCOP 1.55
  
• d3bcce2 appears in SCOPe 2.02
  
• d3bcce2 appears in SCOPe 2.04
  
• d3bcce2 appears in the current release, SCOPe 2.08