Lineage for d3bcce2 (3bcc E:1-69)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1237971Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1238471Superfamily f.23.12: ISP transmembrane anchor [81502] (1 family) (S)
  5. 1238472Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)
  6. 1238473Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species)
  7. 1238485Species Chicken (Gallus gallus) [TaxId:9031] [81498] (3 PDB entries)
  8. 1238488Domain d3bcce2: 3bcc E:1-69 [43713]
    Other proteins in same PDB: d3bcca1, d3bcca2, d3bccb1, d3bccb2, d3bccc2, d3bccc3, d3bccd2, d3bccd3, d3bcce1, d3bccf_, d3bccg_, d3bcch_, d3bccj_
    complexed with amy, fes, hem, sig

Details for d3bcce2

PDB Entry: 3bcc (more details), 3.7 Å

PDB Description: stigmatellin and antimycin bound cytochrome bc1 complex from chicken
PDB Compounds: (E:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d3bcce2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bcce2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Chicken (Gallus gallus) [TaxId: 9031]}
shtdikvpnfsdyrrppddystkssresdpsrkgfsylvtavttlgvayaaknvvtqfvs
smsasadvl

SCOPe Domain Coordinates for d3bcce2:

Click to download the PDB-style file with coordinates for d3bcce2.
(The format of our PDB-style files is described here.)

Timeline for d3bcce2: