Lineage for d3bccd3 (3bcc D:196-241)

  1. Root: SCOP 1.65
  2. 340091Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)
  3. 340729Fold f.23: Single transmembrane helix [81407] (22 superfamilies)
    not a true fold
  4. 340893Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (1 family) (S)
  5. 340894Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein)
  6. 340895Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (3 species)
  7. 340902Species Chicken (Gallus gallus) [TaxId:9031] [81492] (3 PDB entries)
  8. 340905Domain d3bccd3: 3bcc D:196-241 [43712]
    Other proteins in same PDB: d3bcca1, d3bcca2, d3bccb1, d3bccb2, d3bccc2, d3bccc3, d3bccd2, d3bcce1, d3bcce2, d3bccf_, d3bccg_, d3bcch_, d3bccj_
    complexed with amy, fes, hem, sig

Details for d3bccd3

PDB Entry: 3bcc (more details), 3.7 Å

PDB Description: stigmatellin and antimycin bound cytochrome bc1 complex from chicken

SCOP Domain Sequences for d3bccd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bccd3 f.23.11.1 (D:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Chicken (Gallus gallus)}
pehdhrkrmglkmllmmgllvplvyymkrhkwsvlksrklayrppk

SCOP Domain Coordinates for d3bccd3:

Click to download the PDB-style file with coordinates for d3bccd3.
(The format of our PDB-style files is described here.)

Timeline for d3bccd3: