Lineage for d3bccd3 (3bcc D:196-241)

  1. Root: SCOP 1.61
  2. 201426Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 201495Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 201496Superfamily f.2.1: Membrane all-alpha [56869] (13 families) (S)
  5. 201866Family f.2.1.8: Cytochrome bc1 transmembrane subunits [56906] (1 protein)
  6. 201867Protein Cytochrome bc1 transmembrane subunits [56907] (3 species)
  7. 201890Species Chicken (Gallus gallus) [TaxId:9031] [56909] (3 PDB entries)
  8. 201906Domain d3bccd3: 3bcc D:196-241 [43712]
    Other proteins in same PDB: d3bcca1, d3bcca2, d3bccb1, d3bccb2, d3bccd2, d3bcce1

Details for d3bccd3

PDB Entry: 3bcc (more details), 3.7 Å

PDB Description: stigmatellin and antimycin bound cytochrome bc1 complex from chicken

SCOP Domain Sequences for d3bccd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bccd3 f.2.1.8 (D:196-241) Cytochrome bc1 transmembrane subunits {Chicken (Gallus gallus)}
pehdhrkrmglkmllmmgllvplvyymkrhkwsvlksrklayrppk

SCOP Domain Coordinates for d3bccd3:

Click to download the PDB-style file with coordinates for d3bccd3.
(The format of our PDB-style files is described here.)

Timeline for d3bccd3: