SCOP 1.71: Domain d2bccj_: 2bcc J:

Lineage for d2bccj_ (2bcc J:)

1. Root: SCOP 1.71

2. Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family)

5. Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (1 protein)

6. Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species)
   interacts with cytochrome c1 and ISP

7. Species Chicken (Gallus gallus) [TaxId:9031] [81510] (3 PDB entries)

8. Domain d2bccj_: 2bcc J: [43710]
   Other proteins in same PDB: d2bcca1, d2bcca2, d2bccb1, d2bccb2, d2bccc2, d2bccc3, d2bccd2, d2bccd3, d2bcce1, d2bcce2, d2bccf_, d2bccg_, d2bcch_
   complexed with bog, fes, hem, pee, sig, u10

Details for d2bccj_

PDB Entry: 2bcc, 3.5 Å

PDB Description: stigmatellin-bound cytochrome bc1 complex from chicken

SCOP Domain Sequences for d2bccj_:

Sequence; same for both SEQRES and ATOM records:

>d2bccj_ f.23.14.1 (J:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Chicken (Gallus gallus)}
tltarlysllfrrtstfaltivvgallferafdqgadaiyehinegklwkhikhkyenk

Timeline for d2bccj_:

• d2bccj_ first appeared (with stable ids) in SCOP 1.55, called d2bccj1
  
• d2bccj_ appears in SCOP 1.69
  
• d2bccj_ appears in SCOP 1.73
  
• d2bccj_ appears in the current release, SCOPe 2.08