Lineage for d2bccj1 (2bcc J:)

  1. Root: SCOP 1.59
  2. 141686Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 141752Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 141753Superfamily f.2.1: Membrane all-alpha [56869] (11 families) (S)
  5. 142085Family f.2.1.8: Cytochrome bc1 transmembrane subunits [56906] (1 protein)
  6. 142086Protein Cytochrome bc1 transmembrane subunits [56907] (3 species)
  7. 142095Species Chicken (Gallus gallus) [TaxId:9031] [56909] (3 PDB entries)
  8. 142109Domain d2bccj1: 2bcc J: [43710]
    Other proteins in same PDB: d2bcca1, d2bcca2, d2bccb1, d2bccb2, d2bccd2, d2bcce1

Details for d2bccj1

PDB Entry: 2bcc (more details), 3.5 Å

PDB Description: stigmatellin-bound cytochrome bc1 complex from chicken

SCOP Domain Sequences for d2bccj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bccj1 f.2.1.8 (J:) Cytochrome bc1 transmembrane subunits {Chicken (Gallus gallus)}
tltarlysllfrrtstfaltivvgallferafdqgadaiyehinegklwkhikhkyenk

SCOP Domain Coordinates for d2bccj1:

Click to download the PDB-style file with coordinates for d2bccj1.
(The format of our PDB-style files is described here.)

Timeline for d2bccj1: