Lineage for d2bcch1 (2bcc H:)

  1. Root: SCOP 1.57
  2. 87528Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 87593Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 87594Superfamily f.2.1: Membrane all-alpha [56869] (10 families) (S)
  5. 87917Family f.2.1.8: Cytochrome bc1 transmembrane subunits [56906] (1 protein)
  6. 87918Protein Cytochrome bc1 transmembrane subunits [56907] (3 species)
  7. 87927Species Chicken (Gallus gallus) [TaxId:9031] [56909] (3 PDB entries)
  8. 87940Domain d2bcch1: 2bcc H: [43709]
    Other proteins in same PDB: d2bcca1, d2bcca2, d2bccb1, d2bccb2, d2bccd2, d2bcce1

Details for d2bcch1

PDB Entry: 2bcc (more details), 3.5 Å

PDB Description: stigmatellin-bound cytochrome bc1 complex from chicken

SCOP Domain Sequences for d2bcch1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bcch1 f.2.1.8 (H:) Cytochrome bc1 transmembrane subunits {Chicken (Gallus gallus)}
lvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelfdflhardhcvahk
lfnslk

SCOP Domain Coordinates for d2bcch1:

Click to download the PDB-style file with coordinates for d2bcch1.
(The format of our PDB-style files is described here.)

Timeline for d2bcch1: