SCOPe 2.02: Domain d2bccg_: 2bcc G:

Lineage for d2bccg_ (2bcc G:)

1. Root: SCOPe 2.02

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family)

5. Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins)

6. Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
   together with cytochrome b binds to ubiquinone

7. Species Chicken (Gallus gallus) [TaxId:9031] [81504] (3 PDB entries)

8. Domain d2bccg_: 2bcc G: [43708]
   Other proteins in same PDB: d2bcca1, d2bcca2, d2bccb1, d2bccb2, d2bccc2, d2bccc3, d2bccd2, d2bccd3, d2bcce1, d2bcce2, d2bccf_, d2bcch_, d2bccj_
   complexed with bog, fes, hem, pee, sig, u10

Details for d2bccg_

PDB Entry: 2bcc, 3.5 Å

PDB Description: stigmatellin-bound cytochrome bc1 complex from chicken

PDB Compounds: (G:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d2bccg_:

Sequence; same for both SEQRES and ATOM records:

>d2bccg_ f.23.13.1 (G:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Chicken (Gallus gallus) [TaxId: 9031]}
rqfghltrvrhlityslspfeqrpfphyfskgvpnvwrrlracilrvappflafyllytw
gtqefekskrknpaayvn

Timeline for d2bccg_:

• d2bccg_ first appeared (with stable ids) in SCOP 1.55, called d2bccg1
  
• d2bccg_ appears in SCOPe 2.01
  
• d2bccg_ appears in SCOPe 2.03
  
• d2bccg_ appears in the current release, SCOPe 2.08