SCOP 1.57: Domain d2bccg1: 2bcc G:

Lineage for d2bccg1 (2bcc G:)

1. Root: SCOP 1.57

2. Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)

3. Fold f.2: Membrane all-alpha [56868] (1 superfamily)

4. Superfamily f.2.1: Membrane all-alpha [56869] (10 families)

5. Family f.2.1.8: Cytochrome bc1 transmembrane subunits [56906] (1 protein)

6. Protein Cytochrome bc1 transmembrane subunits [56907] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [56909] (3 PDB entries)

8. Domain d2bccg1: 2bcc G: [43708]
   Other proteins in same PDB: d2bcca1, d2bcca2, d2bccb1, d2bccb2, d2bccd2, d2bcce1

Details for d2bccg1

PDB Entry: 2bcc, 3.5 Å

PDB Description: stigmatellin-bound cytochrome bc1 complex from chicken

SCOP Domain Sequences for d2bccg1:

Sequence; same for both SEQRES and ATOM records:

>d2bccg1 f.2.1.8 (G:) Cytochrome bc1 transmembrane subunits {Chicken (Gallus gallus)}
rqfghltrvrhlityslspfeqrpfphyfskgvpnvwrrlracilrvappflafyllytw
gtqefekskrknpaayvn

Timeline for d2bccg1:

• d2bccg1 first appeared (with stable ids) in SCOP 1.55
  
• d2bccg1 appears in SCOP 1.59
  
• d2bccg1 appears in the current release, SCOPe 2.08, called d2bccg_