Lineage for d2bccf_ (2bcc F:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1060623Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 1060624Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) (S)
    location - matrix side of the bc1 complex
  5. 1060625Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
    probably important for the complex assembly, caps the matrix face of cytochrome b
  6. 1060626Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species)
  7. 1060633Species Chicken (Gallus gallus) [TaxId:9031] [81520] (3 PDB entries)
  8. 1060635Domain d2bccf_: 2bcc F: [43707]
    Other proteins in same PDB: d2bcca1, d2bcca2, d2bccb1, d2bccb2, d2bccc2, d2bccc3, d2bccd2, d2bccd3, d2bcce1, d2bcce2, d2bccg_, d2bcch_, d2bccj_
    complexed with bog, fes, hem, pee, sig, u10

Details for d2bccf_

PDB Entry: 2bcc (more details), 3.5 Å

PDB Description: stigmatellin-bound cytochrome bc1 complex from chicken
PDB Compounds: (F:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d2bccf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bccf_ f.27.1.1 (F:) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Chicken (Gallus gallus) [TaxId: 9031]}
srwlegirkwyynaagfnkyglmrddtiyenddvkeairrlpenlyddrmfrikraldln
mrqqilpkeqwtkyeedvpylepylkevirerkereewdk

SCOPe Domain Coordinates for d2bccf_:

Click to download the PDB-style file with coordinates for d2bccf_.
(The format of our PDB-style files is described here.)

Timeline for d2bccf_: