Lineage for d2bcce2 (2bcc E:1-69)

  1. Root: SCOP 1.71
  2. 619386Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)
  3. 620228Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 620462Superfamily f.23.12: ISP transmembrane anchor [81502] (1 family) (S)
  5. 620463Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)
  6. 620464Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species)
  7. 620471Species Chicken (Gallus gallus) [TaxId:9031] [81498] (3 PDB entries)
  8. 620473Domain d2bcce2: 2bcc E:1-69 [43706]
    Other proteins in same PDB: d2bcca1, d2bcca2, d2bccb1, d2bccb2, d2bccc2, d2bccc3, d2bccd2, d2bccd3, d2bcce1, d2bccf_, d2bccg_, d2bcch_, d2bccj_
    complexed with bog, fes, hem, pee, sig, u10

Details for d2bcce2

PDB Entry: 2bcc (more details), 3.5 Å

PDB Description: stigmatellin-bound cytochrome bc1 complex from chicken

SCOP Domain Sequences for d2bcce2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bcce2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Chicken (Gallus gallus)}
shtdikvpnfsdyrrppddystkssresdpsrkgfsylvtavttlgvayaaknvvtqfvs
smsasadvl

SCOP Domain Coordinates for d2bcce2:

Click to download the PDB-style file with coordinates for d2bcce2.
(The format of our PDB-style files is described here.)

Timeline for d2bcce2: