Lineage for d2bccd3 (2bcc D:196-241)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1237971Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1238430Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (1 family) (S)
  5. 1238431Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein)
  6. 1238432Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (3 species)
  7. 1238444Species Chicken (Gallus gallus) [TaxId:9031] [81492] (3 PDB entries)
  8. 1238446Domain d2bccd3: 2bcc D:196-241 [43705]
    Other proteins in same PDB: d2bcca1, d2bcca2, d2bccb1, d2bccb2, d2bccc2, d2bccc3, d2bccd2, d2bcce1, d2bcce2, d2bccf_, d2bccg_, d2bcch_, d2bccj_
    complexed with bog, fes, hem, pee, sig, u10

Details for d2bccd3

PDB Entry: 2bcc (more details), 3.5 Å

PDB Description: stigmatellin-bound cytochrome bc1 complex from chicken
PDB Compounds: (D:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d2bccd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bccd3 f.23.11.1 (D:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Chicken (Gallus gallus) [TaxId: 9031]}
pehdhrkrmglkmllmmgllvplvyymkrhkwsvlksrklayrppk

SCOPe Domain Coordinates for d2bccd3:

Click to download the PDB-style file with coordinates for d2bccd3.
(The format of our PDB-style files is described here.)

Timeline for d2bccd3: