Lineage for d2bccd3 (2bcc D:196-241)

  1. Root: SCOP 1.55
  2. 38777Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 38834Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 38835Superfamily f.2.1: Membrane all-alpha [56869] (10 families) (S)
  5. 39135Family f.2.1.8: Cytochrome bc1 transmembrane subunits [56906] (1 protein)
  6. 39136Protein Cytochrome bc1 transmembrane subunits [56907] (2 species)
  7. 39137Species Chicken (Gallus gallus) [TaxId:9031] [56909] (3 PDB entries)
  8. 39146Domain d2bccd3: 2bcc D:196-241 [43705]
    Other proteins in same PDB: d2bcca_, d2bccb_, d2bccd2, d2bcce1

Details for d2bccd3

PDB Entry: 2bcc (more details), 3.5 Å

PDB Description: stigmatellin-bound cytochrome bc1 complex from chicken

SCOP Domain Sequences for d2bccd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bccd3 f.2.1.8 (D:196-241) Cytochrome bc1 transmembrane subunits {Chicken (Gallus gallus)}
pehdhrkrmglkmllmmgllvplvyymkrhkwsvlksrklayrppk

SCOP Domain Coordinates for d2bccd3:

Click to download the PDB-style file with coordinates for d2bccd3.
(The format of our PDB-style files is described here.)

Timeline for d2bccd3:

39146
d2bccd3 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2bccd2