| Class f: Membrane and cell surface proteins and peptides [56835] (49 folds) |
| Fold f.23: Single transmembrane helix [81407] (30 superfamilies) not a true fold |
Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) ![]() |
| Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (1 protein) |
| Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species) interacts with cytochrome c1 and ISP |
| Species Chicken (Gallus gallus) [TaxId:9031] [81510] (3 PDB entries) |
| Domain d1bccj_: 1bcc J: [43703] Other proteins in same PDB: d1bcca1, d1bcca2, d1bccb1, d1bccb2, d1bccc2, d1bccc3, d1bccd2, d1bccd3, d1bcce1, d1bcce2, d1bccf_, d1bccg_, d1bcch_ complexed with bog, fes, hem, pee, u10 |
PDB Entry: 1bcc (more details), 3.16 Å
SCOP Domain Sequences for d1bccj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bccj_ f.23.14.1 (J:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Chicken (Gallus gallus)}
tltarlysllfrrtstfaltivvgallferafdqgadaiyehinegklwkhikhkyenk
Timeline for d1bccj_: