SCOP 1.59: Domain d1bcch1: 1bcc H:

Lineage for d1bcch1 (1bcc H:)

1. Root: SCOP 1.59

2. Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)

3. Fold f.2: Membrane all-alpha [56868] (1 superfamily)

4. Superfamily f.2.1: Membrane all-alpha [56869] (11 families)

5. Family f.2.1.8: Cytochrome bc1 transmembrane subunits [56906] (1 protein)

6. Protein Cytochrome bc1 transmembrane subunits [56907] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [56909] (3 PDB entries)

8. Domain d1bcch1: 1bcc H: [43702]
   Other proteins in same PDB: d1bcca1, d1bcca2, d1bccb1, d1bccb2, d1bccd2, d1bcce1

Details for d1bcch1

PDB Entry: 1bcc, 3.16 Å

PDB Description: cytochrome bc1 complex from chicken

SCOP Domain Sequences for d1bcch1:

Sequence; same for both SEQRES and ATOM records:

>d1bcch1 f.2.1.8 (H:) Cytochrome bc1 transmembrane subunits {Chicken (Gallus gallus)}
lvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelfdflhardhcvahk
lfnslk

Timeline for d1bcch1:

• d1bcch1 first appeared (with stable ids) in SCOP 1.55
  
• d1bcch1 appears in SCOP 1.57
  
• d1bcch1 appears in SCOP 1.61
  
• d1bcch1 appears in the current release, SCOPe 2.08, called d1bcch_