SCOPe 2.03: Domain d1bccg_: 1bcc G:

Lineage for d1bccg_ (1bcc G:)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family)
   automatically mapped to Pfam PF02939

5. Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins)

6. Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
   together with cytochrome b binds to ubiquinone

7. Species Chicken (Gallus gallus) [TaxId:9031] [81504] (3 PDB entries)

8. Domain d1bccg_: 1bcc G: [43701]
   Other proteins in same PDB: d1bcca1, d1bcca2, d1bccb1, d1bccb2, d1bccc2, d1bccc3, d1bccd2, d1bccd3, d1bcce1, d1bcce2, d1bccf_, d1bcch_, d1bccj_
   complexed with bog, fes, hem, pee, u10

Details for d1bccg_

PDB Entry: 1bcc, 3.16 Å

PDB Description: cytochrome bc1 complex from chicken

PDB Compounds: (G:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d1bccg_:

Sequence; same for both SEQRES and ATOM records:

>d1bccg_ f.23.13.1 (G:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Chicken (Gallus gallus) [TaxId: 9031]}
rqfghltrvrhlityslspfeqrpfphyfskgvpnvwrrlracilrvappflafyllytw
gtqefekskrknpaayvn

Timeline for d1bccg_:

• d1bccg_ first appeared (with stable ids) in SCOP 1.55, called d1bccg1
  
• d1bccg_ appears in SCOPe 2.02
  
• d1bccg_ appears in SCOPe 2.04
  
• d1bccg_ appears in the current release, SCOPe 2.08