SCOPe 2.06: Domain d1bccf_: 1bcc F:

Lineage for d1bccf_ (1bcc F:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family)
   location - matrix side of the bc1 complex
   automatically mapped to Pfam PF02271

5. Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
   probably important for the complex assembly, caps the matrix face of cytochrome b

6. Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [81520] (3 PDB entries)

8. Domain d1bccf_: 1bcc F: [43700]
   Other proteins in same PDB: d1bcca1, d1bcca2, d1bccb1, d1bccb2, d1bccc2, d1bccc3, d1bccd2, d1bccd3, d1bcce1, d1bcce2, d1bccg_, d1bcch_, d1bccj_
   complexed with bog, fes, hem, pee, u10

Details for d1bccf_

PDB Entry: 1bcc, 3.16 Å

PDB Description: cytochrome bc1 complex from chicken

PDB Compounds: (F:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d1bccf_:

Sequence; same for both SEQRES and ATOM records:

>d1bccf_ f.27.1.1 (F:) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Chicken (Gallus gallus) [TaxId: 9031]}
srwlegirkwyynaagfnkyglmrddtiyenddvkeairrlpenlyddrmfrikraldln
mrqqilpkeqwtkyeedvpylepylkevirerkereewdk

Timeline for d1bccf_:

• d1bccf_ first appeared (with stable ids) in SCOP 1.55, called d1bccf1
  
• d1bccf_ appears in SCOPe 2.05
  
• d1bccf_ appears in SCOPe 2.07
  
• d1bccf_ appears in the current release, SCOPe 2.08