Lineage for d1bccf1 (1bcc F:)

  1. Root: SCOP 1.59
  2. 141686Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 141752Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 141753Superfamily f.2.1: Membrane all-alpha [56869] (11 families) (S)
  5. 142085Family f.2.1.8: Cytochrome bc1 transmembrane subunits [56906] (1 protein)
  6. 142086Protein Cytochrome bc1 transmembrane subunits [56907] (3 species)
  7. 142095Species Chicken (Gallus gallus) [TaxId:9031] [56909] (3 PDB entries)
  8. 142099Domain d1bccf1: 1bcc F: [43700]
    Other proteins in same PDB: d1bcca1, d1bcca2, d1bccb1, d1bccb2, d1bccd2, d1bcce1

Details for d1bccf1

PDB Entry: 1bcc (more details), 3.16 Å

PDB Description: cytochrome bc1 complex from chicken

SCOP Domain Sequences for d1bccf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bccf1 f.2.1.8 (F:) Cytochrome bc1 transmembrane subunits {Chicken (Gallus gallus)}
srwlegirkwyynaagfnkyglmrddtiyenddvkeairrlpenlyddrmfrikraldln
mrqqilpkeqwtkyeedvpylepylkevirerkereewdk

SCOP Domain Coordinates for d1bccf1:

Click to download the PDB-style file with coordinates for d1bccf1.
(The format of our PDB-style files is described here.)

Timeline for d1bccf1: