| Class f: Membrane and cell surface proteins and peptides [56835] (12 folds) |
| Fold f.2: Membrane all-alpha [56868] (1 superfamily) |
Superfamily f.2.1: Membrane all-alpha [56869] (11 families) ![]() |
| Family f.2.1.8: Cytochrome bc1 transmembrane subunits [56906] (1 protein) |
| Protein Cytochrome bc1 transmembrane subunits [56907] (3 species) |
| Species Chicken (Gallus gallus) [TaxId:9031] [56909] (3 PDB entries) |
| Domain d1bccf1: 1bcc F: [43700] Other proteins in same PDB: d1bcca1, d1bcca2, d1bccb1, d1bccb2, d1bccd2, d1bcce1 |
PDB Entry: 1bcc (more details), 3.16 Å
SCOP Domain Sequences for d1bccf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bccf1 f.2.1.8 (F:) Cytochrome bc1 transmembrane subunits {Chicken (Gallus gallus)}
srwlegirkwyynaagfnkyglmrddtiyenddvkeairrlpenlyddrmfrikraldln
mrqqilpkeqwtkyeedvpylepylkevirerkereewdk
Timeline for d1bccf1: