![]() | Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) |
![]() | Fold f.2: Membrane all-alpha [56868] (1 superfamily) |
![]() | Superfamily f.2.1: Membrane all-alpha [56869] (10 families) ![]() |
![]() | Family f.2.1.8: Cytochrome bc1 transmembrane subunits [56906] (1 protein) |
![]() | Protein Cytochrome bc1 transmembrane subunits [56907] (2 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [56909] (3 PDB entries) |
![]() | Domain d1bccf1: 1bcc F: [43700] Other proteins in same PDB: d1bcca_, d1bccb_, d1bccd2, d1bcce1 |
PDB Entry: 1bcc (more details), 3.16 Å
SCOP Domain Sequences for d1bccf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bccf1 f.2.1.8 (F:) Cytochrome bc1 transmembrane subunits {Chicken (Gallus gallus)} srwlegirkwyynaagfnkyglmrddtiyenddvkeairrlpenlyddrmfrikraldln mrqqilpkeqwtkyeedvpylepylkevirerkereewdk
Timeline for d1bccf1: