Lineage for d1bcce2 (1bcc E:1-69)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1456646Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1457215Superfamily f.23.12: ISP transmembrane anchor [81502] (1 family) (S)
  5. 1457216Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)
  6. 1457217Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species)
  7. 1457229Species Chicken (Gallus gallus) [TaxId:9031] [81498] (3 PDB entries)
  8. 1457230Domain d1bcce2: 1bcc E:1-69 [43699]
    Other proteins in same PDB: d1bcca1, d1bcca2, d1bccb1, d1bccb2, d1bccc2, d1bccc3, d1bccd2, d1bccd3, d1bcce1, d1bccf_, d1bccg_, d1bcch_, d1bccj_
    complexed with bog, fes, hem, pee, u10

Details for d1bcce2

PDB Entry: 1bcc (more details), 3.16 Å

PDB Description: cytochrome bc1 complex from chicken
PDB Compounds: (E:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d1bcce2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bcce2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Chicken (Gallus gallus) [TaxId: 9031]}
shtdikvpnfsdyrrppddystkssresdpsrkgfsylvtavttlgvayaaknvvtqfvs
smsasadvl

SCOPe Domain Coordinates for d1bcce2:

Click to download the PDB-style file with coordinates for d1bcce2.
(The format of our PDB-style files is described here.)

Timeline for d1bcce2: