![]() | Class f: Membrane and cell surface proteins and peptides [56835] (47 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (30 superfamilies) not a true fold |
![]() | Superfamily f.23.12: ISP transmembrane anchor [81502] (1 family) ![]() |
![]() | Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins) |
![]() | Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [81498] (3 PDB entries) |
![]() | Domain d1bcce2: 1bcc E:1-69 [43699] Other proteins in same PDB: d1bcca1, d1bcca2, d1bccb1, d1bccb2, d1bccc2, d1bccc3, d1bccd2, d1bccd3, d1bcce1, d1bccf_, d1bccg_, d1bcch_, d1bccj_ |
PDB Entry: 1bcc (more details), 3.16 Å
SCOP Domain Sequences for d1bcce2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bcce2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Chicken (Gallus gallus)} shtdikvpnfsdyrrppddystkssresdpsrkgfsylvtavttlgvayaaknvvtqfvs smsasadvl
Timeline for d1bcce2: