SCOPe 2.03: Domain d1bccd3: 1bcc D:196-241

Lineage for d1bccd3 (1bcc D:196-241)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families)

5. Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein)

6. Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [81492] (3 PDB entries)

8. Domain d1bccd3: 1bcc D:196-241 [43698]
   Other proteins in same PDB: d1bcca1, d1bcca2, d1bccb1, d1bccb2, d1bccc2, d1bccc3, d1bccd2, d1bcce1, d1bcce2, d1bccf_, d1bccg_, d1bcch_, d1bccj_
   complexed with bog, fes, hem, pee, u10

Details for d1bccd3

PDB Entry: 1bcc, 3.16 Å

PDB Description: cytochrome bc1 complex from chicken

PDB Compounds: (D:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d1bccd3:

Sequence; same for both SEQRES and ATOM records:

>d1bccd3 f.23.11.1 (D:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Chicken (Gallus gallus) [TaxId: 9031]}
pehdhrkrmglkmllmmgllvplvyymkrhkwsvlksrklayrppk

Timeline for d1bccd3:

• d1bccd3 first appeared (with stable ids) in SCOP 1.55
  
• d1bccd3 appears in SCOPe 2.02
  
• d1bccd3 appears in SCOPe 2.04
  
• d1bccd3 appears in the current release, SCOPe 2.08