SCOP 1.69: Domain d1bccd3: 1bcc D:196-241

Lineage for d1bccd3 (1bcc D:196-241)

1. Root: SCOP 1.69

2. Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (1 family)

5. Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein)

6. Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [81492] (3 PDB entries)

8. Domain d1bccd3: 1bcc D:196-241 [43698]
   Other proteins in same PDB: d1bcca1, d1bcca2, d1bccb1, d1bccb2, d1bccc2, d1bccc3, d1bccd2, d1bcce1, d1bcce2, d1bccf_, d1bccg_, d1bcch_, d1bccj_

Details for d1bccd3

PDB Entry: 1bcc, 3.16 Å

PDB Description: cytochrome bc1 complex from chicken

SCOP Domain Sequences for d1bccd3:

Sequence; same for both SEQRES and ATOM records:

>d1bccd3 f.23.11.1 (D:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Chicken (Gallus gallus)}
pehdhrkrmglkmllmmgllvplvyymkrhkwsvlksrklayrppk

Timeline for d1bccd3:

• d1bccd3 first appeared (with stable ids) in SCOP 1.55
  
• d1bccd3 appears in SCOP 1.67
  
• d1bccd3 appears in SCOP 1.71
  
• d1bccd3 appears in the current release, SCOPe 2.08