SCOPe 2.07: Domain d1bgyt_: 1bgy T:

Lineage for d1bgyt_ (1bgy T:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family)
   location - intermembrane side of the bc1 complex
   automatically mapped to Pfam PF02320

5. Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins)
   "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1

6. Protein Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81529] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81526] (14 PDB entries)
   Uniprot P00126

8. Domain d1bgyt_: 1bgy T: [43694]
   Other proteins in same PDB: d1bgya1, d1bgya2, d1bgyb1, d1bgyb2, d1bgyc2, d1bgyc3, d1bgyd2, d1bgyd3, d1bgye_, d1bgyf_, d1bgyg_, d1bgyi_, d1bgyj_, d1bgyk_, d1bgym1, d1bgym2, d1bgyn1, d1bgyn2, d1bgyo2, d1bgyo3, d1bgyp2, d1bgyp3, d1bgyq1, d1bgyq2, d1bgyr_, d1bgys_, d1bgyu_, d1bgyv_, d1bgyw_
   complexed with fes, hec, hem

Details for d1bgyt_

PDB Entry: 1bgy, 3 Å

PDB Description: cytochrome bc1 complex from bovine

PDB Compounds: (T:) cytochrome bc1 complex

SCOPe Domain Sequences for d1bgyt_:

Sequence; same for both SEQRES and ATOM records:

>d1bgyt_ f.28.1.1 (T:) Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
dplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvahklf
nslk

Timeline for d1bgyt_:

• d1bgyt_ first appeared (with stable ids) in SCOP 1.55, called d1bgyt1
  
• d1bgyt_ appears in SCOPe 2.06
  
• d1bgyt_ appears in the current release, SCOPe 2.08